SCOP 1.73: Domain d1bbdh1: 1bbd H:1-119

Lineage for d1bbdh1 (1bbd H:1-119)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (34 PDB entries)

8. Domain d1bbdh1: 1bbd H:1-119 [19783]
   Other proteins in same PDB: d1bbdh2, d1bbdl1, d1bbdl2
   part of Fab 8F5
   complexed with so4

Details for d1bbdh1

PDB Entry: 1bbd, 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

PDB Compounds: (H:) igg2a-kappa 8f5 fab (heavy chain)

SCOP Domain Sequences for d1bbdh1:

Sequence; same for both SEQRES and ATOM records:

>d1bbdh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssa

Timeline for d1bbdh1:

• d1bbdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1bbdh1 appears in SCOP 1.71
  
• d1bbdh1 appears in SCOP 1.75
  
• d1bbdh1 appears in the current release, SCOPe 2.08