Lineage for d1bbdh1 (1bbd H:1-119)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287384Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)
  8. 287411Domain d1bbdh1: 1bbd H:1-119 [19783]
    Other proteins in same PDB: d1bbdh2, d1bbdl1, d1bbdl2
    part of Fab 8F5
    complexed with so4

Details for d1bbdh1

PDB Entry: 1bbd (more details), 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

SCOP Domain Sequences for d1bbdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbdh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssa

SCOP Domain Coordinates for d1bbdh1:

Click to download the PDB-style file with coordinates for d1bbdh1.
(The format of our PDB-style files is described here.)

Timeline for d1bbdh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbdh2