Lineage for d1bbdh1 (1bbd H:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740181Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2740207Domain d1bbdh1: 1bbd H:1-119 [19783]
    Other proteins in same PDB: d1bbdh2, d1bbdl1, d1bbdl2
    part of Fab 8F5
    complexed with so4

Details for d1bbdh1

PDB Entry: 1bbd (more details), 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2
PDB Compounds: (H:) igg2a-kappa 8f5 fab (heavy chain)

SCOPe Domain Sequences for d1bbdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbdh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssa

SCOPe Domain Coordinates for d1bbdh1:

Click to download the PDB-style file with coordinates for d1bbdh1.
(The format of our PDB-style files is described here.)

Timeline for d1bbdh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbdh2