Lineage for d2c1de1 (2c1d E:27-179)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691699Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry)
  8. 2691704Domain d2c1de1: 2c1d E:27-179 [197829]
    automated match to d1h32a1
    complexed with hec, zn

Details for d2c1de1

PDB Entry: 2c1d (more details), 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus
PDB Compounds: (E:) soxa

SCOPe Domain Sequences for d2c1de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1de1 a.3.1.0 (E:27-179) automated matches {Paracoccus denitrificans [TaxId: 266]}
dpvedglvietdsgpveivtktappafladtfdtiysgwhfrddstrdlerddfdnpamv
fvdrgldkwnaamgvngescaschqgpesmaglravmprvdehtgklmimedyvnacvte
rmglekwgvtsdnmkdmlslislqsrgmavnvk

SCOPe Domain Coordinates for d2c1de1:

Click to download the PDB-style file with coordinates for d2c1de1.
(The format of our PDB-style files is described here.)

Timeline for d2c1de1: