| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry) |
| Domain d2c1da2: 2c1d A:180-290 [197826] automated match to d1h32a2 complexed with hec, zn |
PDB Entry: 2c1d (more details), 1.92 Å
SCOPe Domain Sequences for d2c1da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1da2 a.3.1.0 (A:180-290) automated matches {Paracoccus denitrificans [TaxId: 266]}
idgpaapywehgkeiyytrygqlemscanchednagnmiradhlsqgqingfptyrlkds
gmvtaqhrfvgcvrdtraetfkagsddfkalelyvasrgnglsvegvsvrh
Timeline for d2c1da2: