Lineage for d2c0la_ (2c0l A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
  6. 2333906Protein automated matches [190103] (4 species)
    not a true protein
  7. 2333911Species Human (Homo sapiens) [TaxId:9606] [186825] (12 PDB entries)
  8. 2333917Domain d2c0la_: 2c0l A: [197824]
    Other proteins in same PDB: d2c0lb_
    automated match to d2j9qb_

Details for d2c0la_

PDB Entry: 2c0l (more details), 2.3 Å

PDB Description: tpr domain of human pex5p in complex with human mscp2
PDB Compounds: (A:) peroxisomal targeting signal 1 receptor

SCOPe Domain Sequences for d2c0la_:

Sequence, based on SEQRES records: (download)

>d2c0la_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisalrr
clelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvtpaeegaggaglgp
skrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaa
lsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahre
avehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltm
fglpq

Sequence, based on observed residues (ATOM records): (download)

>d2c0la_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisalrr
clelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvpskrilgsllsdsl
flevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsvrpndyllwnk
lgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreavehflealnmqr
ksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq

SCOPe Domain Coordinates for d2c0la_:

Click to download the PDB-style file with coordinates for d2c0la_.
(The format of our PDB-style files is described here.)

Timeline for d2c0la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c0lb_