SCOPe 2.08: Domain d2c0ka_: 2c0k A:

Lineage for d2c0ka_ (2c0k A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Gasterophilus intestinalis [TaxId:84525] [193835] (1 PDB entry)

8. Domain d2c0ka_: 2c0k A: [197823]
   automated match to d2c0kb_
   complexed with hem, oxy

Details for d2c0ka_

PDB Entry: 2c0k, 2.6 Å

PDB Description: the structure of hemoglobin from the botfly gasterophilus intestinalis

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d2c0ka_:

Sequence; same for both SEQRES and ATOM records:

>d2c0ka_ a.1.1.0 (A:) automated matches {Gasterophilus intestinalis [TaxId: 84525]}
mnseevndikrtwevvaakmteagvemlkryfkkyphnlnhfpwfkeipfddlpenarfk
thgtrilrqvdegvkalsvdfgdkkfddvwkklaqthhekkverrsynelkdiiievvcs
cvklnekqvhayhkffdraydiafaemakm

Timeline for d2c0ka_:

• d2c0ka_ first appeared in SCOPe 2.03
  
• d2c0ka_ appears in SCOPe 2.07