SCOP 1.75: Domain d1a3rh1: 1a3r H:2-119

Lineage for d1a3rh1 (1a3r H:2-119)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1a3rh1: 1a3r H:2-119 [19781]
   Other proteins in same PDB: d1a3rh2, d1a3rl1, d1a3rl2
   part of Fab 8F5
   complexed with nh2

Details for d1a3rh1

PDB Entry: 1a3r, 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

PDB Compounds: (H:) igg2a 8f5 fab (heavy chain)

SCOP Domain Sequences for d1a3rh1:

Sequence; same for both SEQRES and ATOM records:

>d1a3rh1 b.1.1.1 (H:2-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
vqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytkyd
pkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssakt
tap

Timeline for d1a3rh1:

• d1a3rh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a3rh1 appears in SCOP 1.73
  
• d1a3rh1 appears in SCOPe 2.01
  
• d1a3rh1 appears in the current release, SCOPe 2.08