![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab 8F5 (mouse), kappa L chain [48755] (2 PDB entries) |
![]() | Domain d1a3rh1: 1a3r H:2-119 [19781] Other proteins in same PDB: d1a3rh2, d1a3rl2 |
PDB Entry: 1a3r (more details), 2.1 Å
SCOP Domain Sequences for d1a3rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3rh1 b.1.1.1 (H:2-119) Immunoglobulin (variable domains of L and H chains) {Fab 8F5 (mouse), kappa L chain} vqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytkyd pkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssakt tap
Timeline for d1a3rh1: