Lineage for d1a3rh1 (1a3r H:2-119)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7483Species Fab 8F5 (mouse), kappa L chain [48755] (2 PDB entries)
  8. 7484Domain d1a3rh1: 1a3r H:2-119 [19781]
    Other proteins in same PDB: d1a3rh2, d1a3rl2

Details for d1a3rh1

PDB Entry: 1a3r (more details), 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3rh1 b.1.1.1 (H:2-119) Immunoglobulin (variable domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
vqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytkyd
pkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssakt
tap

SCOP Domain Coordinates for d1a3rh1:

Click to download the PDB-style file with coordinates for d1a3rh1.
(The format of our PDB-style files is described here.)

Timeline for d1a3rh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3rh2