Lineage for d2bsec_ (2bse C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777054Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)
  7. 2777055Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries)
    Uniprot Q71AW2 162-264
  8. 2777064Domain d2bsec_: 2bse C: [197807]
    Other proteins in same PDB: d2bsed1, d2bsed2, d2bsee1, d2bsee2, d2bsef1, d2bsef2
    automated match to d1zrua1

Details for d2bsec_

PDB Entry: 2bse (more details), 2.7 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
PDB Compounds: (C:) receptor binding protein

SCOPe Domain Sequences for d2bsec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsec_ b.21.1.3 (C:) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d2bsec_:

Click to download the PDB-style file with coordinates for d2bsec_.
(The format of our PDB-style files is described here.)

Timeline for d2bsec_: