SCOPe 2.05: Domain d2bseb_: 2bse B:

Lineage for d2bseb_ (2bse B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
   automatically mapped to Pfam PF08932

6. Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)

7. Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries)
   Uniprot Q71AW2 162-264

8. Domain d2bseb_: 2bse B: [197806]
   Other proteins in same PDB: d2bsed_, d2bsee_, d2bsef_
   automated match to d1zrua1

Details for d2bseb_

PDB Entry: 2bse, 2.7 Å

PDB Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain

PDB Compounds: (B:) receptor binding protein

SCOPe Domain Sequences for d2bseb_:

Sequence; same for both SEQRES and ATOM records:

>d2bseb_ b.21.1.3 (B:) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

Timeline for d2bseb_:

• d2bseb_ first appeared in SCOPe 2.03
  
• d2bseb_ appears in SCOPe 2.04
  
• d2bseb_ appears in SCOPe 2.06
  
• d2bseb_ appears in the current release, SCOPe 2.08