| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
| Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species) |
| Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries) Uniprot Q71AW2 162-264 |
| Domain d2bsea_: 2bse A: [197805] Other proteins in same PDB: d2bsed1, d2bsed2, d2bsee1, d2bsee2, d2bsef1, d2bsef2 automated match to d1zrua1 |
PDB Entry: 2bse (more details), 2.7 Å
SCOPe Domain Sequences for d2bsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsea_ b.21.1.3 (A:) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
Timeline for d2bsea_: