SCOPe 2.07: Domain d2bobb2: 2bob B:108-212

Lineage for d2bobb2 (2bob B:108-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d2bobb2: 2bob B:108-212 [197802]
   Other proteins in same PDB: d2boba1, d2boba2, d2boba3, d2bobb1, d2bobc_
   automated match to d1r3ja2
   complexed with co, tba, tl

Details for d2bobb2

PDB Entry: 2bob, 2.76 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetrabutylammonium (tba)

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d2bobb2:

Sequence; same for both SEQRES and ATOM records:

>d2bobb2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2bobb2:

• d2bobb2 first appeared in SCOPe 2.03
  
• d2bobb2 appears in SCOPe 2.06
  
• d2bobb2 appears in the current release, SCOPe 2.08