Lineage for d1a3rl1 (1a3r L:1-114)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363702Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)
  8. 363714Domain d1a3rl1: 1a3r L:1-114 [19780]
    Other proteins in same PDB: d1a3rh1, d1a3rh2, d1a3rl2
    part of Fab 8F5
    complexed with nh2

Details for d1a3rl1

PDB Entry: 1a3r (more details), 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3rl1 b.1.1.1 (L:1-114) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt

SCOP Domain Coordinates for d1a3rl1:

Click to download the PDB-style file with coordinates for d1a3rl1.
(The format of our PDB-style files is described here.)

Timeline for d1a3rl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3rl2