SCOPe 2.03: Domain d2bnua2: 2bnu A:116-204

Lineage for d2bnua2 (2bnu A:116-204)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d2bnua2: 2bnu A:116-204 [197798]
   Other proteins in same PDB: d2bnua1, d2bnub1, d2bnub2
   automated match to d1qrnd2

Details for d2bnua2

PDB Entry: 2bnu, 1.4 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (A:) T-cell receptor alpha chain c region

SCOPe Domain Sequences for d2bnua2:

Sequence; same for both SEQRES and ATOM records:

>d2bnua2 b.1.1.2 (A:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrrskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d2bnua2:

• d2bnua2 is new in SCOPe 2.03-stable
  
• d2bnua2 appears in SCOPe 2.04
  
• d2bnua2 appears in the current release, SCOPe 2.08