Lineage for d2bkuc_ (2bku C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868029Species Dog (Canis familiaris) [TaxId:9615] [224975] (1 PDB entry)
  8. 2868031Domain d2bkuc_: 2bku C: [197792]
    Other proteins in same PDB: d2bkub1, d2bkud_
    automated match to d3ea5a_
    complexed with gtp, mg

Details for d2bkuc_

PDB Entry: 2bku (more details), 2.7 Å

PDB Description: kap95p:rangtp complex
PDB Compounds: (C:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d2bkuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkuc_ c.37.1.8 (C:) automated matches {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

SCOPe Domain Coordinates for d2bkuc_:

Click to download the PDB-style file with coordinates for d2bkuc_.
(The format of our PDB-style files is described here.)

Timeline for d2bkuc_: