![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (16 species) not a true protein |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [224975] (1 PDB entry) |
![]() | Domain d2bkua_: 2bku A: [197791] Other proteins in same PDB: d2bkub1, d2bkud_ automated match to d3ea5a_ complexed with gtp, mg |
PDB Entry: 2bku (more details), 2.7 Å
SCOPe Domain Sequences for d2bkua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkua_ c.37.1.8 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]} vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
Timeline for d2bkua_: