Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Dog (Canis familiaris) [TaxId:9615] [224975] (1 PDB entry) |
Domain d2bkua_: 2bku A: [197791] Other proteins in same PDB: d2bkub1, d2bkud_ automated match to d3ea5a_ complexed with gtp, mg |
PDB Entry: 2bku (more details), 2.7 Å
SCOPe Domain Sequences for d2bkua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkua_ c.37.1.8 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]} vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
Timeline for d2bkua_: