SCOP 1.63: Domain d1bafh1: 1baf H:1-115

Lineage for d1bafh1 (1baf H:1-115)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab ANO2 (mouse), kappa L chain [48754] (1 PDB entry)

8. Domain d1bafh1: 1baf H:1-115 [19779]
   Other proteins in same PDB: d1bafh2, d1bafl2
   complexed with npp

Details for d1bafh1

PDB Entry: 1baf, 2.9 Å

PDB Description: 2.9 angstroms resolution structure of an anti-dinitrophenyl-spin-label monoclonal antibody fab fragment with bound hapten

SCOP Domain Sequences for d1bafh1:

Sequence; same for both SEQRES and ATOM records:

>d1bafh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab ANO2 (mouse), kappa L chain}
dvqlqesgpglvkpsqsqsltctvtgysitsdyawnwirqfpgnklewmgymsysgstry
npslrsrisitrdtsknqfflqlksvttedtatyfcargwplaywgqgtqvsvse

Timeline for d1bafh1:

• d1bafh1 first appeared (with stable ids) in SCOP 1.55
  
• d1bafh1 appears in SCOP 1.61
  
• d1bafh1 appears in SCOP 1.65
  
• d1bafh1 appears in the current release, SCOPe 2.08