Lineage for d2bfeb2 (2bfe B:205-342)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1370884Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1370885Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1370937Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
    automatically mapped to Pfam PF02780
  6. 1370945Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 1370946Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries)
    Uniprot P21953 52-392
  8. 1370951Domain d2bfeb2: 2bfe B:205-342 [197789]
    Other proteins in same PDB: d2bfea1, d2bfeb1
    automated match to d1x7yb2
    complexed with cl, gol, k, mn, mrd, tdp

Details for d2bfeb2

PDB Entry: 2bfe (more details), 1.69 Å

PDB Description: reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bfeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfeb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOPe Domain Coordinates for d2bfeb2:

Click to download the PDB-style file with coordinates for d2bfeb2.
(The format of our PDB-style files is described here.)

Timeline for d2bfeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bfeb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bfea1