Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries) Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595 |
Domain d2be2a2: 2be2 A:430-552 [197785] Other proteins in same PDB: d2be2a1, d2be2b_ automated match to d1s9ea1 complexed with gol, mn, r22, suc |
PDB Entry: 2be2 (more details), 2.43 Å
SCOPe Domain Sequences for d2be2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be2a2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d2be2a2: