Lineage for d2be2a1 (2be2 A:1-429)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622423Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2622424Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2622468Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (204 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2622689Domain d2be2a1: 2be2 A:1-429 [197784]
    Other proteins in same PDB: d2be2a2
    automated match to d1s9ea2
    complexed with gol, mn, r22, suc

Details for d2be2a1

PDB Entry: 2be2 (more details), 2.43 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d2be2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be2a1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d2be2a1:

Click to download the PDB-style file with coordinates for d2be2a1.
(The format of our PDB-style files is described here.)

Timeline for d2be2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2be2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2be2b_