SCOP 1.57: Domain d1bafl1: 1baf L:1-108

Lineage for d1bafl1 (1baf L:1-108)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab ANO2 (mouse), kappa L chain [48754] (1 PDB entry)

8. Domain d1bafl1: 1baf L:1-108 [19778]
   Other proteins in same PDB: d1bafh2, d1bafl2

Details for d1bafl1

PDB Entry: 1baf, 2.9 Å

PDB Description: 2.9 angstroms resolution structure of an anti-dinitrophenyl-spin-label monoclonal antibody fab fragment with bound hapten

SCOP Domain Sequences for d1bafl1:

Sequence; same for both SEQRES and ATOM records:

>d1bafl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab ANO2 (mouse), kappa L chain}
qivltqspaimsaspgekvtmtcsasssvyymywyqqkpgssprlliydtsnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqwssyppitfgvgtklelkr

Timeline for d1bafl1:

• d1bafl1 first appeared (with stable ids) in SCOP 1.55
  
• d1bafl1 appears in SCOP 1.59
  
• d1bafl1 appears in the current release, SCOPe 2.08