Lineage for d2b7dl2 (2b7d L:87-142)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 protein domains)
  6. 2582613Protein Coagulation factor VIIa [57201] (1 species)
  7. 2582614Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2582718Domain d2b7dl2: 2b7d L:87-142 [197779]
    Other proteins in same PDB: d2b7dh_, d2b7dt1, d2b7dt2
    automated match to d1danl2
    complexed with c1b

Details for d2b7dl2

PDB Entry: 2b7d (more details), 2.24 Å

PDB Description: factor viia inhibitors: chemical optimization, preclinical pharmacokinetics, pharmacodynamics, and efficacy in a baboon thrombosis model
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2b7dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7dl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d2b7dl2:

Click to download the PDB-style file with coordinates for d2b7dl2.
(The format of our PDB-style files is described here.)

Timeline for d2b7dl2: