Lineage for d2avwe_ (2avw E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155304Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 protein domains)
    automatically mapped to Pfam PF09028
  6. 2155309Protein automated matches [193829] (1 species)
    not a true protein
  7. 2155310Species Streptococcus pyogenes [TaxId:293653] [193830] (1 PDB entry)
  8. 2155315Domain d2avwe_: 2avw E: [197773]
    automated match to d2avwf_
    complexed with gol, so4

Details for d2avwe_

PDB Entry: 2avw (more details), 2 Å

PDB Description: Crystal structure of monoclinic form of streptococcus Mac-1
PDB Compounds: (E:) IgG-degrading protease

SCOPe Domain Sequences for d2avwe_:

Sequence, based on SEQRES records: (download)

>d2avwe_ d.3.1.12 (E:) automated matches {Streptococcus pyogenes [TaxId: 293653]}
evtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagn
mlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekaf
pylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskll
tsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiy
vtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt

Sequence, based on observed residues (ATOM records): (download)

>d2avwe_ d.3.1.12 (E:) automated matches {Streptococcus pyogenes [TaxId: 293653]}
evtpyvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnm
lhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafp
ylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskllt
srhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyv
tdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt

SCOPe Domain Coordinates for d2avwe_:

Click to download the PDB-style file with coordinates for d2avwe_.
(The format of our PDB-style files is described here.)

Timeline for d2avwe_: