SCOPe 2.03: Domain d2avwb_: 2avw B:

Lineage for d2avwb_ (2avw B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins)
   automatically mapped to Pfam PF09028

6. Protein automated matches [193829] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:293653] [193830] (1 PDB entry)

8. Domain d2avwb_: 2avw B: [197770]
   automated match to d2avwf_
   complexed with gol, so4

Details for d2avwb_

PDB Entry: 2avw, 2 Å

PDB Description: crystal structure of monoclinic form of streptococcus mac-1

PDB Compounds: (B:) IgG-degrading protease

SCOPe Domain Sequences for d2avwb_:

Sequence; same for both SEQRES and ATOM records:

>d2avwb_ d.3.1.12 (B:) automated matches {Streptococcus pyogenes [TaxId: 293653]}
vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn

Timeline for d2avwb_:

• d2avwb_ is new in SCOPe 2.03-stable
  
• d2avwb_ appears in SCOPe 2.04
  
• d2avwb_ appears in the current release, SCOPe 2.08