Lineage for d7fabh1 (7fab H:1-116)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103627Species Human (Homo sapiens), cluster 2.1 [TaxId:9606] [88545] (3 PDB entries)
  8. 1103628Domain d7fabh1: 7fab H:1-116 [19777]
    Other proteins in same PDB: d7fabh2, d7fabl1, d7fabl2
    part of Fab NEW

Details for d7fabh1

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
PDB Compounds: (H:) igg1-lambda new fab (heavy chain)

SCOPe Domain Sequences for d7fabh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]}
avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvs

SCOPe Domain Coordinates for d7fabh1:

Click to download the PDB-style file with coordinates for d7fabh1.
(The format of our PDB-style files is described here.)

Timeline for d7fabh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabh2