Lineage for d2aska_ (2ask A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963683Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 1963684Protein automated matches [190506] (3 species)
    not a true protein
  7. 1963685Species Human (Homo sapiens) [TaxId:9606] [187459] (17 PDB entries)
  8. 1963686Domain d2aska_: 2ask A: [197760]
    automated match to d2askb_
    complexed with so4

Details for d2aska_

PDB Entry: 2ask (more details), 1.55 Å

PDB Description: Structure of human Artemin
PDB Compounds: (A:) artemin

SCOPe Domain Sequences for d2aska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aska_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
argcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgclg

SCOPe Domain Coordinates for d2aska_:

Click to download the PDB-style file with coordinates for d2aska_.
(The format of our PDB-style files is described here.)

Timeline for d2aska_: