SCOP 1.75: Domain d7fabl1: 7fab L:1-103

Lineage for d7fabl1 (7fab L:1-103)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88538] (1 PDB entry)

8. Domain d7fabl1: 7fab L:1-103 [19776]
   Other proteins in same PDB: d7fabh1, d7fabh2, d7fabl2
   part of Fab NEW

Details for d7fabl1

PDB Entry: 7fab, 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

PDB Compounds: (L:) igg1-lambda new fab (light chain)

SCOP Domain Sequences for d7fabl1:

Sequence; same for both SEQRES and ATOM records:

>d7fabl1 b.1.1.1 (L:1-103) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlr

Timeline for d7fabl1:

• d7fabl1 first appeared (with stable ids) in SCOP 1.55
  
• d7fabl1 appears in SCOP 1.73
  
• d7fabl1 appears in SCOPe 2.01
  
• d7fabl1 appears in the current release, SCOPe 2.08