Lineage for d2ai0n2 (2ai0 N:114-216)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296998Domain d2ai0n2: 2ai0 N:114-216 [197754]
    Other proteins in same PDB: d2ai0h1, d2ai0i1, d2ai0j1, d2ai0k1, d2ai0l1, d2ai0m1, d2ai0n1, d2ai0o1
    automated match to d2jell2
    complexed with gol, so4

Details for d2ai0n2

PDB Entry: 2ai0 (more details), 2.2 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form iii
PDB Compounds: (N:) immunoglobulin light chain kappa

SCOPe Domain Sequences for d2ai0n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ai0n2 b.1.1.0 (N:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2ai0n2:

Click to download the PDB-style file with coordinates for d2ai0n2.
(The format of our PDB-style files is described here.)

Timeline for d2ai0n2: