Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d2ai0n2: 2ai0 N:114-216 [197754] Other proteins in same PDB: d2ai0h1, d2ai0i1, d2ai0j1, d2ai0k1, d2ai0l1, d2ai0m1, d2ai0n1, d2ai0o1 automated match to d2jell2 complexed with gol, so4 |
PDB Entry: 2ai0 (more details), 2.2 Å
SCOPe Domain Sequences for d2ai0n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ai0n2 b.1.1.0 (N:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2ai0n2: