Lineage for d8fabc1 (8fab C:3-105)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288345Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (3 PDB entries)
  8. 288347Domain d8fabc1: 8fab C:3-105 [19774]
    Other proteins in same PDB: d8faba2, d8fabb1, d8fabb2, d8fabc2, d8fabd1, d8fabd2
    part of Fab HIL

Details for d8fabc1

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8fabc1 b.1.1.1 (C:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5}
eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltv

SCOP Domain Coordinates for d8fabc1:

Click to download the PDB-style file with coordinates for d8fabc1.
(The format of our PDB-style files is described here.)

Timeline for d8fabc1: