SCOPe 2.05: Domain d2a77l2: 2a77 L:114-216

Lineage for d2a77l2 (2a77 L:114-216)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d2a77l2: 2a77 L:114-216 [197739]
   Other proteins in same PDB: d2a77h1, d2a77l1
   automated match to d2jell2
   complexed with gol, so4

Details for d2a77l2

PDB Entry: 2a77, 1.8 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form ii

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d2a77l2:

Sequence, based on SEQRES records:

>d2a77l2 b.1.1.0 (L:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d2a77l2 b.1.1.0 (L:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktspivksfnr

Timeline for d2a77l2:

• d2a77l2 first appeared in SCOPe 2.03
  
• d2a77l2 appears in SCOPe 2.04
  
• d2a77l2 appears in SCOPe 2.06
  
• d2a77l2 appears in the current release, SCOPe 2.08