Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries) |
Domain d2a77l1: 2a77 L:1-113 [197738] Other proteins in same PDB: d2a77h1, d2a77l2 automated match to d2jell1 complexed with gol, so4 |
PDB Entry: 2a77 (more details), 1.8 Å
SCOPe Domain Sequences for d2a77l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a77l1 b.1.1.1 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgkspklliykvsnrf sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskr
Timeline for d2a77l1: