SCOPe 2.03: Domain d2a77l1: 2a77 L:1-113

Lineage for d2a77l1 (2a77 L:1-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)

8. Domain d2a77l1: 2a77 L:1-113 [197738]
   Other proteins in same PDB: d2a77h1, d2a77l2
   automated match to d2jell1
   complexed with gol, so4

Details for d2a77l1

PDB Entry: 2a77, 1.8 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form ii

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d2a77l1:

Sequence; same for both SEQRES and ATOM records:

>d2a77l1 b.1.1.1 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgkspklliykvsnrf
sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskr

Timeline for d2a77l1:

• d2a77l1 is new in SCOPe 2.03-stable
  
• d2a77l1 appears in SCOPe 2.04
  
• d2a77l1 appears in the current release, SCOPe 2.08