Lineage for d2a6jl2 (2a6j L:108-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1295189Domain d2a6jl2: 2a6j L:108-214 [197736]
    Other proteins in same PDB: d2a6ja1, d2a6jb1, d2a6jh1, d2a6jl1
    automated match to d1dqdl2

Details for d2a6jl2

PDB Entry: 2a6j (more details), 2.7 Å

PDB Description: crystal structure analysis of the anti-arsonate germline antibody 36- 65
PDB Compounds: (L:) Germline antibody 36-65 Fab light chain

SCOPe Domain Sequences for d2a6jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6jl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2a6jl2:

Click to download the PDB-style file with coordinates for d2a6jl2.
(The format of our PDB-style files is described here.)

Timeline for d2a6jl2: