SCOPe 2.08: Domain d2a6jl2: 2a6j L:108-214

Lineage for d2a6jl2 (2a6j L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2a6jl2: 2a6j L:108-214 [197736]
   Other proteins in same PDB: d2a6ja1, d2a6jb2, d2a6jb3, d2a6jh2, d2a6jh3, d2a6jl1
   automated match to d1dqdl2

Details for d2a6jl2

PDB Entry: 2a6j, 2.7 Å

PDB Description: crystal structure analysis of the anti-arsonate germline antibody 36- 65

PDB Compounds: (L:) Germline antibody 36-65 Fab light chain

SCOPe Domain Sequences for d2a6jl2:

Sequence; same for both SEQRES and ATOM records:

>d2a6jl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2a6jl2:

• d2a6jl2 first appeared in SCOPe 2.03
  
• d2a6jl2 appears in SCOPe 2.07