Lineage for d2a6jl1 (2a6j L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761108Domain d2a6jl1: 2a6j L:1-107 [197735]
    Other proteins in same PDB: d2a6ja2, d2a6jb2, d2a6jb3, d2a6jh2, d2a6jh3, d2a6jl2
    automated match to d1dqdl1

Details for d2a6jl1

PDB Entry: 2a6j (more details), 2.7 Å

PDB Description: crystal structure analysis of the anti-arsonate germline antibody 36- 65
PDB Compounds: (L:) Germline antibody 36-65 Fab light chain

SCOPe Domain Sequences for d2a6jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6jl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleik

SCOPe Domain Coordinates for d2a6jl1:

Click to download the PDB-style file with coordinates for d2a6jl1.
(The format of our PDB-style files is described here.)

Timeline for d2a6jl1: