Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein CED-4, NB-ARC domain [159577] (1 species) belongs to Pfam PF00931 |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [159578] (1 PDB entry) Uniprot P30429 109-385 |
Domain d2a5yc1: 2a5y C:109-385 [197731] Other proteins in same PDB: d2a5ya_, d2a5yb1, d2a5yb2, d2a5yc2 automated match to d2a5yb3 complexed with atp, mg |
PDB Entry: 2a5y (more details), 2.6 Å
SCOPe Domain Sequences for d2a5yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5yc1 c.37.1.20 (C:109-385) CED-4, NB-ARC domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} qfsrqmldrklllgnvpkqmtcyireyhvdrvikkldemcdldsfflflhgragsgksvi asqalsksdqliginydsivwlkdsgtapkstfdlftdillmlkseddllnfpsvehvts vvlkrmicnalidrpntlfvfddvvqeetirwaqelrlrclvttrdveisnaasqtcefi evtsleidecydfleaygmpmpvgekeedvlnktielssgnpatlmmffkscepktfekm aqlnnklesrglvgvecitpysykslamalqrcvevl
Timeline for d2a5yc1:
View in 3D Domains from other chains: (mouse over for more information) d2a5ya_, d2a5yb1, d2a5yb2, d2a5yb3 |