SCOPe 2.07: Domain d2a5yc1: 2a5y C:109-385

Lineage for d2a5yc1 (2a5y C:109-385)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein CED-4, NB-ARC domain [159577] (1 species)
   belongs to Pfam PF00931

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [159578] (1 PDB entry)
   Uniprot P30429 109-385

8. Domain d2a5yc1: 2a5y C:109-385 [197731]
   Other proteins in same PDB: d2a5ya_, d2a5yb1, d2a5yb2, d2a5yc2
   automated match to d2a5yb3
   complexed with atp, mg

Details for d2a5yc1

PDB Entry: 2a5y, 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex

PDB Compounds: (C:) ced-4

SCOPe Domain Sequences for d2a5yc1:

Sequence; same for both SEQRES and ATOM records:

>d2a5yc1 c.37.1.20 (C:109-385) CED-4, NB-ARC domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qfsrqmldrklllgnvpkqmtcyireyhvdrvikkldemcdldsfflflhgragsgksvi
asqalsksdqliginydsivwlkdsgtapkstfdlftdillmlkseddllnfpsvehvts
vvlkrmicnalidrpntlfvfddvvqeetirwaqelrlrclvttrdveisnaasqtcefi
evtsleidecydfleaygmpmpvgekeedvlnktielssgnpatlmmffkscepktfekm
aqlnnklesrglvgvecitpysykslamalqrcvevl

Timeline for d2a5yc1:

• d2a5yc1 first appeared in SCOPe 2.03
  
• d2a5yc1 appears in SCOPe 2.06
  
• d2a5yc1 appears in the current release, SCOPe 2.08