Lineage for d8fabb1 (8fab B:1-121)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287255Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (10 PDB entries)
  8. 287256Domain d8fabb1: 8fab B:1-121 [19773]
    Other proteins in same PDB: d8faba1, d8faba2, d8fabb2, d8fabc1, d8fabc2, d8fabd2

Details for d8fabb1

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8fabb1 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3}
avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
s

SCOP Domain Coordinates for d8fabb1:

Click to download the PDB-style file with coordinates for d8fabb1.
(The format of our PDB-style files is described here.)

Timeline for d8fabb1: