SCOP 1.59: Domain d8fabb1: 8fab B:1-121

Lineage for d8fabb1 (8fab B:1-121)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab HIL (human), lambda L chain [48752] (1 PDB entry)

8. Domain d8fabb1: 8fab B:1-121 [19773]
   Other proteins in same PDB: d8faba2, d8fabb2, d8fabc2, d8fabd2

Details for d8fabb1

PDB Entry: 8fab, 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabb1:

Sequence; same for both SEQRES and ATOM records:

>d8fabb1 b.1.1.1 (B:1-121) Immunoglobulin (variable domains of L and H chains) {Fab HIL (human), lambda L chain}
avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
s

Timeline for d8fabb1:

• d8fabb1 first appeared (with stable ids) in SCOP 1.55
  
• d8fabb1 appears in SCOP 1.57
  
• d8fabb1 appears in SCOP 1.61
  
• d8fabb1 appears in the current release, SCOPe 2.08