Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d2a1wm1: 2a1w M:1-113 [197729] Other proteins in same PDB: d2a1wh1, d2a1wi1, d2a1wl2, d2a1wm2 automated match to d2jell1 complexed with so4 |
PDB Entry: 2a1w (more details), 2.7 Å
SCOPe Domain Sequences for d2a1wm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1wm1 b.1.1.1 (M:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskr
Timeline for d2a1wm1:
View in 3D Domains from other chains: (mouse over for more information) d2a1wh1, d2a1wi1, d2a1wl1, d2a1wl2 |