Lineage for d2a1wl2 (2a1w L:114-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761062Domain d2a1wl2: 2a1w L:114-216 [197728]
    Other proteins in same PDB: d2a1wh_, d2a1wi_, d2a1wl1, d2a1wm1
    automated match to d2jell2
    complexed with so4

Details for d2a1wl2

PDB Entry: 2a1w (more details), 2.7 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form i
PDB Compounds: (L:) immunoglobulin light chain kappa

SCOPe Domain Sequences for d2a1wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1wl2 b.1.1.0 (L:114-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2a1wl2:

Click to download the PDB-style file with coordinates for d2a1wl2.
(The format of our PDB-style files is described here.)

Timeline for d2a1wl2: