![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) ![]() |
![]() | Family a.60.14.0: automated matches [227301] (1 protein) not a true family |
![]() | Protein automated matches [227127] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries) |
![]() | Domain d2a1aa2: 2a1a A:89-175 [197726] Other proteins in same PDB: d2a1aa1, d2a1ab_ automated match to d1kl9a1 |
PDB Entry: 2a1a (more details), 2.8 Å
SCOPe Domain Sequences for d2a1aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1aa2 a.60.14.0 (A:89-175) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi idetvwegieppskdvldelknyiskr
Timeline for d2a1aa2: