SCOPe 2.03: Domain d2a1aa2: 2a1a A:89-175

Lineage for d2a1aa2 (2a1a A:89-175)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families)

5. Family a.60.14.0: automated matches [227301] (1 protein)
   not a true family

6. Protein automated matches [227127] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries)

8. Domain d2a1aa2: 2a1a A:89-175 [197726]
   Other proteins in same PDB: d2a1aa1, d2a1ab_
   automated match to d1kl9a1

Details for d2a1aa2

PDB Entry: 2a1a, 2.8 Å

PDB Description: pkr kinase domain-eif2alpha complex

PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a1aa2:

Sequence; same for both SEQRES and ATOM records:

>d2a1aa2 a.60.14.0 (A:89-175) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyiskr

Timeline for d2a1aa2:

• d2a1aa2 is new in SCOPe 2.03-stable
  
• d2a1aa2 appears in SCOPe 2.04
  
• d2a1aa2 appears in the current release, SCOPe 2.08