Lineage for d2a1aa2 (2a1a A:89-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716745Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2716759Family a.60.14.0: automated matches [227301] (1 protein)
    not a true family
  6. 2716760Protein automated matches [227127] (2 species)
    not a true protein
  7. 2716761Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries)
  8. 2716763Domain d2a1aa2: 2a1a A:89-175 [197726]
    Other proteins in same PDB: d2a1aa1, d2a1ab1, d2a1ab2
    automated match to d1kl9a1

Details for d2a1aa2

PDB Entry: 2a1a (more details), 2.8 Å

PDB Description: pkr kinase domain-eif2alpha complex
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a1aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1aa2 a.60.14.0 (A:89-175) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyiskr

SCOPe Domain Coordinates for d2a1aa2:

Click to download the PDB-style file with coordinates for d2a1aa2.
(The format of our PDB-style files is described here.)

Timeline for d2a1aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a1aa1