Lineage for d2a1aa1 (2a1a A:3-88)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542187Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225013] (2 PDB entries)
  8. 1542189Domain d2a1aa1: 2a1a A:3-88 [197725]
    Other proteins in same PDB: d2a1aa2, d2a1ab_
    automated match to d1kl9a2

Details for d2a1aa1

PDB Entry: 2a1a (more details), 2.8 Å

PDB Description: pkr kinase domain-eif2alpha complex
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a1aa1:

Sequence, based on SEQRES records: (download)

>d2a1aa1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkli
rvgkndvavvlrvdkekgyidlskrr

Sequence, based on observed residues (ATOM records): (download)

>d2a1aa1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillslirvgkndvavvlr
vdkekgyidlskrr

SCOPe Domain Coordinates for d2a1aa1:

Click to download the PDB-style file with coordinates for d2a1aa1.
(The format of our PDB-style files is described here.)

Timeline for d2a1aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a1aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2a1ab_