Lineage for d2a19a1 (2a19 A:3-88)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060484Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225013] (2 PDB entries)
  8. 2060485Domain d2a19a1: 2a19 A:3-88 [197723]
    Other proteins in same PDB: d2a19a2, d2a19a3, d2a19b1, d2a19b2, d2a19c1, d2a19c2
    automated match to d1kl9a2
    complexed with anp, mg, po4

Details for d2a19a1

PDB Entry: 2a19 (more details), 2.5 Å

PDB Description: pkr kinase domain- eif2alpha- amp-pnp complex.
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a19a1:

Sequence, based on SEQRES records: (download)

>d2a19a1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkli
rvgkndvavvlrvdkekgyidlskrr

Sequence, based on observed residues (ATOM records): (download)

>d2a19a1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillssiqklirvgkndva
vvlrvdkekgyidlskrr

SCOPe Domain Coordinates for d2a19a1:

Click to download the PDB-style file with coordinates for d2a19a1.
(The format of our PDB-style files is described here.)

Timeline for d2a19a1: