Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (33 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225013] (2 PDB entries) |
Domain d2a19a1: 2a19 A:3-88 [197723] Other proteins in same PDB: d2a19a2, d2a19a3, d2a19b1, d2a19b2, d2a19c1, d2a19c2 automated match to d1kl9a2 complexed with anp, mg, po4 |
PDB Entry: 2a19 (more details), 2.5 Å
SCOPe Domain Sequences for d2a19a1:
Sequence, based on SEQRES records: (download)
>d2a19a1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkli rvgkndvavvlrvdkekgyidlskrr
>d2a19a1 b.40.4.0 (A:3-88) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} shcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillssiqklirvgkndva vvlrvdkekgyidlskrr
Timeline for d2a19a1:
View in 3D Domains from other chains: (mouse over for more information) d2a19b1, d2a19b2, d2a19c1, d2a19c2 |