SCOP 1.63: Domain d8faba1: 8fab A:3-105

Lineage for d8faba1 (8fab A:3-105)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab HIL (human), lambda L chain [48752] (1 PDB entry)

8. Domain d8faba1: 8fab A:3-105 [19772]
   Other proteins in same PDB: d8faba2, d8fabb2, d8fabc2, d8fabd2

Details for d8faba1

PDB Entry: 8fab, 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8faba1:

Sequence; same for both SEQRES and ATOM records:

>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin (variable domains of L and H chains) {Fab HIL (human), lambda L chain}
eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltv

Timeline for d8faba1:

• d8faba1 first appeared (with stable ids) in SCOP 1.55
  
• d8faba1 appears in SCOP 1.61
  
• d8faba1 appears in SCOP 1.65
  
• d8faba1 appears in the current release, SCOPe 2.08