Lineage for d2a06p1 (2a06 P:10-260)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024543Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 3024565Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries)
    Uniprot P00157
  8. 3024569Domain d2a06p1: 2a06 P:10-260 [197718]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_
    automated match to d1ntmc2
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq

Details for d2a06p1

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (P:) Cytochrome b, heme protein, mitochondrial

SCOPe Domain Sequences for d2a06p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06p1 f.21.1.2 (P:10-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
lmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthi
crdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafm
gyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfii
maiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdl
lgdpdnytpan

SCOPe Domain Coordinates for d2a06p1:

Click to download the PDB-style file with coordinates for d2a06p1.
(The format of our PDB-style files is described here.)

Timeline for d2a06p1: