Lineage for d2a06i_ (2a06 I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611009Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2611010Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2611025Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 2611026Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 2611027Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 2611031Domain d2a06i_: 2a06 I: [197717]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06w_
    automated match to d1pp9i_
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq

Details for d2a06i_

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d2a06i_:

Sequence, based on SEQRES records: (download)

>d2a06i_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
aavpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry

Sequence, based on observed residues (ATOM records): (download)

>d2a06i_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry

SCOPe Domain Coordinates for d2a06i_:

Click to download the PDB-style file with coordinates for d2a06i_.
(The format of our PDB-style files is described here.)

Timeline for d2a06i_: