Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) |
Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
Protein automated matches [190458] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries) |
Domain d1zxka_: 1zxk A: [197710] automated match to d1zxkb_ |
PDB Entry: 1zxk (more details), 2 Å
SCOPe Domain Sequences for d1zxka_:
Sequence, based on SEQRES records: (download)
>d1zxka_ b.1.6.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} swvwnqmfvleefsgpepilvgrlhtdldpgskkikyilsgdgagtifqinditgdihai krldreekaeytltaqavdfetnkpleppsefiikvqd
>d1zxka_ b.1.6.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} swvwnqmfvleefsgpepilvgrlhtdldpgkikyilsgdgagtifqinditgdihaikr ldreekaeytltaqavdfetnkpleppsefiikvqd
Timeline for d1zxka_: